General Information

  • ID:  hor000062
  • Uniprot ID:  E9H8T6??26-34)
  • Protein name:  Inotocin
  • Gene name:  NA
  • Organism:  Daphnia pulex (Water flea)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Daphnia (genus), Daphniidae (family), Anomopoda (infraorder), Cladocera (suborder), Diplostraca (order), Phyllopoda (subclass), Branchiopoda (class), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  CFITNCPPG
  • Length:  9(26-34)
  • Propeptide:  MAGLWTFCLIALSMTEMIIPLTAKPCFITNCPPGGKRSSQLVEPSSYLECAPCGPAGKGTCLGANLCCGSHFGCFFKTEETNVCLLTNLKSTQICNQHFWKTDLKSASCSLNGDKIDGICVADLLCCSLGNLPQDDL
  • Signal peptide:  MAGLWTFCLIALSMTEMIIPLTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E9H8T6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000062_AF2.pdbhor000062_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 109400 Formula: C41H62N10O12S2
Absent amino acids: ADEHKLMQRSVWY Common amino acids: CP
pI: 5.84 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: 50 Boman Index: 219
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 43.33
Instability Index: 3178.89 Extinction Coefficient cystines: 125
Absorbance 280nm: 15.63

Literature

  • PubMed ID:  21830762
  • Title:  Genomics, Transcriptomics, and Peptidomics of Daphnia Pulex Neuropeptides and Protein Hormones